PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G03650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 248aa    MW: 26663.9 Da    PI: 9.5513
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G03650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-19116170256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++t eq + Le+ F+ ++ +s++e++eLA klgL+ rqV vWFqNrRa+ k
  OGLUM02G03650.1 116 RKKLRLTGEQATLLEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRARTK 170
                      788899***********************************************98 PP

2HD-ZIP_I/II114.65.9e-37116204189
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      +kk+rl+ eq++lLE+sF++++ L++ +K+ela +Lgl++rqv+vWFqnrRARtk+kq+E d++ L+r++d+l+++n+rL+++ +eLr+
  OGLUM02G03650.1 116 RKKLRLTGEQATLLEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRARTKLKQTEADCDLLRRWCDHLAADNARLRRDLAELRR 204
                      69*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1895173IPR009057Homeodomain-like
PROSITE profilePS5007117.378112172IPR001356Homeobox domain
SMARTSM003893.2E-16114176IPR001356Homeobox domain
SuperFamilySSF466891.8E-18115181IPR009057Homeodomain-like
CDDcd000866.31E-14116173No hitNo description
PfamPF000466.9E-17116170IPR001356Homeobox domain
PRINTSPR000319.2E-7143152IPR000047Helix-turn-helix motif
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
PRINTSPR000319.2E-7152168IPR000047Helix-turn-helix motif
PfamPF021832.7E-7172203IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-10172215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSSSSLTTTS SMDSVVDGGL DTRLSLAVGC CPPRRRPVLL FGEVLPSPEK KVAAAAVVAA  60
GKRGREQRGE AEAEATTTRQ RRSCKKGRRG RGDDDDDDGD RRSPSGGGGD EEGASRKKLR  120
LTGEQATLLE DSFRAHNILS HAEKQELAGK LGLSARQVEV WFQNRRARTK LKQTEADCDL  180
LRRWCDHLAA DNARLRRDLA ELRRSSSSPP VSGLAVATPV VCPSCAHDDK RRLAFATAAA  240
AAGDMASN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120SRKKLRL
2164172RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054120.0AP005412.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0050G13.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624893.11e-177PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX61e-179HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLA0A0D9YMB21e-177A0A0D9YMB2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N9W31e-177A0A0E0N9W3_ORYRU; Uncharacterized protein
STRINGLOC_Os02g05640.11e-169(Oryza sativa Japonica Group)
STRINGBGIOSGA007547-PA1e-169(Oryza sativa Indica Group)
STRINGORGLA02G0035900.11e-169(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-27homeobox protein 2